PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna16655.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family MYB
Protein Properties Length: 1752aa    MW: 197143 Da    PI: 7.9869
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna16655.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding42.21.9e-13774819248
                              SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                              g W   Ede+l+ av ++G+++W++I++ +  ++++kqck rw+ +l
  mrna16655.1-v1.0-hybrid 774 GVWKNTEDEILKAAVMKYGKNQWARISSLLV-RKSAKQCKARWYEWL 819
                              78*****************************.************986 PP

2Myb_DNA-binding31.15.4e-10848890348
                              SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                               WT eEde+l+++ k++++  W+tIa  +g  Rt+ qc +r+ k+l
  mrna16655.1-v1.0-hybrid 848 EWTREEDEKLLHLAKLMPTQ-WRTIAPIVG--RTPSQCLERYEKLL 890
                              6*****************99.********8..**********9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:3.80.10.103.3E-105295IPR032675Leucine-rich repeat domain, L domain-like
PROSITE profilePS501818.59752100IPR001810F-box domain
SuperFamilySSF813836.54E-105295IPR001810F-box domain
SMARTSM002560.00735898IPR001810F-box domain
Gene3DG3DSA:3.80.10.103.3E-10168432IPR032675Leucine-rich repeat domain, L domain-like
SuperFamilySSF520472.35E-7207408No hitNo description
PfamPF083873.1E-6430473IPR006566FBD domain
PfamPF118335.1E-10571686IPR021788Protein CHAPERONE-LIKE PROTEIN OF POR1-like
PROSITE profilePS5129422.008768823IPR017930Myb domain
SuperFamilySSF466893.37E-13769825IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.6E-16771825IPR009057Homeodomain-like
SMARTSM007177.0E-15772821IPR001005SANT/Myb domain
PfamPF002492.3E-11774819IPR001005SANT/Myb domain
CDDcd001679.57E-12776819No hitNo description
PROSITE profilePS5129414.131843894IPR017930Myb domain
SMARTSM007176.9E-11845892IPR001005SANT/Myb domain
CDDcd116591.15E-27847893No hitNo description
Gene3DG3DSA:1.10.10.603.8E-10848891IPR009057Homeodomain-like
SuperFamilySSF466899.33E-11848896IPR009057Homeodomain-like
PfamPF139211.1E-8849898No hitNo description
PfamPF118317.7E-5812031444IPR021786Pre-mRNA splicing factor component Cdc5p/Cef1
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009870Biological Processdefense response signaling pathway, resistance gene-dependent
GO:0010204Biological Processdefense response signaling pathway, resistance gene-independent
GO:0042742Biological Processdefense response to bacterium
GO:0050832Biological Processdefense response to fungus
GO:0009507Cellular Componentchloroplast
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 1752 aa     Download sequence    Send to blast
MMKNRACRTS QFLPTKKHEK RSKLKKKENL GKKQRDKGEF SSGNRNGGVS YEDRISDLPD  60
GILLSILSCL LLKEAATTSV LSRRWRDLWA SVMSLNFEDE KNSRDFKEVK PNIQHRQRRS  120
FVSMVDAAVK QHTGLTIERF RACFFLDRRF AQSIDEWIEF AVKKRVQILE LEFSTANYKD  180
NYTFPHELLG LAKGSTQKDL HSGISSLHSS GCCLGFKSLK VLTLRHVNVA GEALENLLMN  240
CPVERLSVVA AKNLVDLRVV SPPITWKYLA IEKCLDLKTI EICNADIVSF TYIGVGIDLV  300
LSNVPLLTEV SITELEIRSN DFYNSIAISV ELPFTQLSCY LSQLKCLTMD ISEVVYNQDY  360
VFPMLANLKC LELICEPHYA SALRYLTSFM KASPYLQRLV LKMNIYTSWL EEMGIGKTEM  420
EEIVTTKQLE SVAKCPHDEL KVIEIVGYRA RRFAAKHVML LLKNAVALKK LVIDPVRHRS  480
RGLSMVKEII DEEMKARNHA VKHLKKYVPS TFPQRNFRPK APPLSFSPPN FRAIPQNRRI  540
VLAAASAAGS SNSDSGLNPY EILGVNPIEG FDKVKETYKR KHKEAMSNGD EEGAATLEKA  600
YDKLMMSQLT NRKKGMTFGS FKVSKDIKYA DKQPIVPWGP RFTKSSGQDI RINLAISAVF  660
VAWIAIVRNA DYKPLQFLSF AFVYRIFEKL KSFEGPVTPK YTEDGEEVGK GLQMGKRLLR  720
ALGLVFGCIA VASLGYTGSL NVIEYMASYV PAILYNNQLP SGDVVKMRIM IKGGVWKNTE  780
DEILKAAVMK YGKNQWARIS SLLVRKSAKQ CKARWYEWLD PSIKKIAMCG LLGLGPCSVG  840
VFGFDLTEWT REEDEKLLHL AKLMPTQWRT IAPIVGRTPS QCLERYEKLL DAACVKDENY  900
EPGDDPRKLR PGEIDPNPES KPARPDPVDM DEDEKEMLSE ARARLANTRG KKAKRKAREK  960
QLEEARRLAS LQKRRELKAA GIDTRQRKRK RKGIDYNAEI PFEKKPPPGF YDVAEEDRPV  1020
EQPQFPTTIE ELEGKRRVDV EAQLRKQDIA KNKIAQRQDA PSAILQANKL NDPETVRKRS  1080
KLMLPAPQIS DHELEEIAKM GYANDLAGSE LTEGSGATRA LLANYAQTPR LGMTPLRTPQ  1140
RTPSGKGDAI MMEASNLAML RESQTPLLGG ENPQLHPSDF SGVTPRKKEI QTPNLMLTPS  1200
MLTPSTPGGA GLTPRFGLTP SRDALGMTPK GTPMRDELRI NEDVDMHDSA KMEHRRQAEL  1260
RKNLQLGLSN LPQPKNEYQI VMQPVPEDDE EPEEKIEEDM SDRIARERAE EEARQQALLR  1320
KRSKVLQREL PRPPATSVES LRKSLLRADE DKSKVVPPTS IEQANEMITK ELLSLLEHDN  1380
AKYPLDEKTD KRKKKGSKRS TNGSTSAVPE IDDFEEDELK EADSMINDEV KYLRVAMGHE  1440
DKSVDEFVEV HKTCMNEFMF FPKRNAYGSS SIAGNEEKLE ALQNEFDNVK KKLDDDLAKA  1500
VSLEKKVKVR THGYEMRAKD THWPKIEETF KQLDTAEKEL ECFRALQKQE QLAASHRINN  1560
LWEEVQKQKE LERTLQKRYG GLLLEVERVQ HLREKYIAQE QEQKEVAARN DLELADAAVD  1620
VTVAQSTGNL DSTSASDELA ASHGETTDPQ VDGMDVDADK KCDMTVTTDV DVPKNTPSVA  1680
EGEKDIPSQG TSGEGSETHL STSDGIPSSD VAAQESVSNG DAVSGSVAKV LPTENLTRTT  1740
VADDQVVGAE I*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3jb9_W1e-9476910112236Pre-mRNA-splicing factor cdc5
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
11925KRSKLKK
2972991KRRELKAAGIDTRQRKRKRK
3986991RKRKRK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00028SELEXTransfer from AT1G09770Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004302089.10.0PREDICTED: cell division cycle 5-like protein
TrEMBLM5WK140.0M5WK14_PRUPE; Uncharacterized protein
STRINGGLYMA20G36600.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF40723354
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G09770.10.0cell division cycle 5